Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj0g3v0360389.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HD-ZIP
Protein Properties Length: 618aa    MW: 68344.6 Da    PI: 6.9534
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj0g3v0360389.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      +++ +++t++q++eLe+lF+++++p++++r eL+++l L++rqVk+WFqNrR+++k
                      688999***********************************************999 PP

            START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaet 81 
                      ela++a++el+k+a+ +ep+W++ +    e++n +e++++f++  +     + +ea+r++g+v+ ++  lve+l+d + +W e+++    + +t
                      5899**************************************99989*******************************.*************** PP

            START  82 levissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwve 168
                       ev+ssg      galqlm  el +lsplvp R++ f+R+++q+++g+w++vd S+d  ++ +  +s+  +++lpSg+++++++ng+skvtwve
                      **************************************************************99****************************** PP

            START 169 hvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                      h++++++++h+l+r+l++sg+ +ga++w atlqrqce+
                      ************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.362121181IPR001356Homeobox domain
SMARTSM003894.7E-17122185IPR001356Homeobox domain
PfamPF000461.5E-18124179IPR001356Homeobox domain
CDDcd000861.15E-17124181No hitNo description
PROSITE patternPS000270156179IPR017970Homeobox, conserved site
PROSITE profilePS5084842.319312548IPR002913START domain
SuperFamilySSF559612.61E-31314545No hitNo description
CDDcd088752.25E-125316544No hitNo description
SMARTSM002341.7E-45321545IPR002913START domain
PfamPF018521.1E-54321545IPR002913START domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 618 aa     Download sequence    Send to blast
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014516480.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
RefseqXP_014516481.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2-like isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLV7ANR50.0V7ANR5_PHAVU; Uncharacterized protein
STRINGGLYMA07G08340.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein